|
|
||||||||
1Graduate Program in Environmental Toxicology, 2Department of Cell Biology and Neuroscience, University of California, Riverside, California
Submitted 7 December 2005 ; accepted in final form 26 January 2007
| ABSTRACT |
|---|
|
|
|---|
ion homeostasis; Aedes aegypti; apical membrane
It has been postulated that the feeding activates as yet unidentified mechanoreceptor(s) in the gut, which in turn prompt the release of neurosecretory factors from the brain that activate signaling pathways that regulate expression and/or activity of ion and fluid transporters in the epithelial tissue of the midgut, gastric caecae, Malpighian tubules (analogous to vertebrate kidneys), hindgut, and rectum (10, 24). Since insect Malpighian tubules are not innervated, regulation of their function is via intrinsic mechanisms and humoral messengers circulating in the hemolymph (4). One factor whose activity has been shown to increase in the mosquito's hemolymph after a blood meal is the CRF-like mosquito natriuretic peptide (MNP) (36, 56). MNP activates receptors in the Malpighian tubules, triggering the release of cAMP, which then activates Na+ channels and Na+-K+-2Cl cotransporters in the basolateral membrane of principal cells (36). Basolateral entry of Na+ and K+ into the principal cell also involves the mostly basolaterally localized AeNHE3 (22, 40). The basolateral Na+-K+-ATPase likely contributes in loading K+ into the principal cells (22, 31, 34, 51). Once the concentration of cytoplasmic Na+ has been elevated, its competitiveness for extrusion across the apical membrane likewise increases.
In animals, the basolateral Na+-K+-ATPase predominantly energizes transepithelial transport; but in an appreciable number of cases, this role is played by the V-type H+-ATPase (20, 57). In mosquitoes for instance, transport across the Malpighian tubule's principal cells is dependent on the electrochemical gradient created by the apical V-ATPase (5). ATP is generated in the dense mitochondrion present in the apical brush-border microvillus of principal cells (3, 55) and used to drive proton extrusion into the lumen. But interestingly, the luminal pH in Aedes aegypti's Malpighian tubules remains stable within the neutral range under both control and active diuretic conditions (37) implying that the protons extruded do not accumulate. This could arise if these protons were recycled back into the principal cells in exchange for Na+ and/or K+ via an apical membrane Na+/H+ exchanger (NHE) protein.
NHEs (solute carrier family 9, SLC 9) are members of the monovalent cation proton antiporter (CPA) superfamily of transporters that are conserved in bacteria and eukaryotes (6). By exchanging H+ for Na+ or K+, they regulate cellular and systemic pH in addition to ionic concentrations in cells (21, 33). The proposed contribution of insect NHEs in epithelial ion transport has been largely inferred from electrophysiological assays involving pharmacological inhibition or activation of fluid and ion secretion in isolated Malpighian tubules (e.g., Ramsay assays) and measurement of the associated changes in pH and electric potential (5, 22, 37, 55). Recent findings that AeNHE3 is predominantly expressed in the basolateral membrane of the principal cells render it an unlikely candidate for the apical exchanger (40).
In this report, we present the functional characterization of a Na+/H+ antiporter from the mosquito A. aegypti, hereafter, AeNHE8. Ion transport, heterologous expression, complementation, and immunolocalization studies indicate that NHE8 is an amiloride-sensitive Na+/H+ antiporter located on the apical membrane of principal cells. Our data suggest that AeNHE8 may play some role in the restoration of Na+ and K+ homeostasis in the mosquito during postblood meal diuresis.
| EXPERIMENTAL PROCEDURES |
|---|
|
|
|---|
Cloning of exchanger, sequence analysis, and expression constructs. Conserved mammalian NHE signature sequences from NHE16 were used to identify genomic, full-length cDNA and EST exchanger sequences from Drosophila and Anopheles databases. Positive hits were classified on the basis of whether they contained or lacked the "VFFLFLLPPII" residue pocket (typically located in the 3rd or 4th transmembrane domain) that is critical for amiloride sensitivity (reviewed in Ref. 8). Putative Anopheles NHE8 and Drosophila NHE1 (16, 41) emerged as potential amiloride-sensitive exchangers. Degenerate primers were then designed against their conserved transmembrane domains to amplify candidates from an A. aegypti cDNA library. Identification of candidate clones was done following the Limited Growth PCR procedure as described (48). These clones were sequenced at the ends using vector primers and aligned against Drosophila and Anopheles NHE genes to ascertain their identity and completeness. A 2,864-bp-long transcript coding for the A. aegypti homolog of Drosophila NHE1 (16) and mouse NHE8 (accession no. AF482993) was identified and deposited in the NCBI GenBank database (accession no. AY326255). It differs from the sequence deposited by TIGR & Broad Institute (http://aaegypti.vectorbase.org/index.php) by one substitution, (i.e., nucleotide A457G). For comparative purposes, we performed a multiple alignment of AeNHE8 sequences against known homologs (from the NCBI database) using ClustalX (50), and the output was visualized on the Boxshade 3.21 interface.
To heterologously express AeNHE8, the transcript's protein coding sequence was amplified by PCR and cloned into pYES 2.1 TOPO (Invitrogen, Carlsbad, CA), a galactose-inducible yeast expression vector. To allow efficient immunoprecipitation of heterologously expressed exchanger, a c-Myc tag was added to the COOH-terminal of AeNHE8 by PCR. For expression in mammalian PS120 cells, AeNHE8 and AeNHE8::cMyc were cloned into the pcDNA3.1(+) vector (Invitrogen). All constructs were fully sequenced to confirm that there were no PCR errors.
Expression of Aedes aegypti NHE8 in Saccharomyces cerevisiae.
S. cerevisiae strains G19 (MAT
, ade2, his3, leu2, trp1, ura3,·ena1::HIS3::ena4) and AXT3 (MAT
, ade2, his3, leu2, trp1, ura3,·ena1::HIS3::ena4, nha1::LEU2, nhx1::TRP1) were gifts from Dr. J. M. Pardo (Consejo Superior de Investigaciones Cientificas, Sevilla, Spain) and have been previously characterized (26, 42). Yeast cells were transformed with pYES2.1 TOPO::AeNHE8 by the LiCl method. Growth in high Na+ was assayed in alkali cation-free arginine phosphate (AP) medium (46) supplemented with the appropriate concentrations of NaCl. Tolerance to hygromycin B (100 µg/ml) was assayed in minimal media.
Expression of AeNHE8 in NHE-deficient PS120 cells. NHE-deficient PS120 cells (38) were maintained in DMEM supplemented with penicillin/streptomycin (Invitrogen) and 10% fetal bovine serum (Invitrogen). To create stable PS120 cell lines expressing AeNHE8 and AeNHE8::c-Myc, Mfe1 linearized constructs were transfected into the cells using Lipofectamine 2000 (Invitrogen). Selection medium (DMEM, 10% fetal bovine serum and antibiotics supplemented with 1 mg/ml G418) was added 2 days posttransfection. Growth was maintained until individual foci were apparent. Surviving cells were trypsinized and grown in selection media as individual stably transfected clones. Following confocal microscopy to determine expression, the clones showing highest expression were selected for 22Na+ uptake assays.
Anti-NHE8 antibodies. Two hydrophilic peptides (WK-215 and WK-69) were designed based on TopPred topology and antigenicity prediction index (http://bioweb.pasteur.fr/seqanal/interfaces/toppred.html). The synthetic peptides WK-215 (C-SGGKKSRKSIRSSRL) comprising residues 511525 and WK-69 (C-QELHDCKSQMADLTNKWYQAIRISPDDLDEEDEEDED) comprising residues 589625 were commercially synthesized, confirmed by mass spectral analyses (Synthetic Biomolecules, San Diego, CA), and conjugated to a maleimide-activated KLH carrier protein (Pierce, Rockford, IL) via the cysteine introduced at the NH2-terminal according to the manufacturer's protocol. This conjugate was used to immunize rabbits. Serum from subsequent bleeds was used in immunohistochemistry and immunoblotting. Antibody preadsorbed with antigen and preimmune serum were used for negative control labeling.
Immunolocalization. Fourth instar larvae and 4- to 10-day-old nonblood fed Ae. aegypti females were fixed overnight in 4% paraformaldehyde (PFA) at 4°C. After fixation, tissues were washed in PBS and dehydrated in a series of ethanol solutions (20, 40, 70, 95%) and finally in 100% ethanol at 4°C overnight. Samples were then passed through an ethanol/xylene series (70/30; 30/70) for 3 h each and three times in 100% xylene for 1416 h each at room temperature (RT). Paraplast chips (Xtra, Fisher Scientific) were added to the xylene and the latter replaced with fresh Paraplast at 58°C over 2 days until tissues were completely infiltrated. These were cut into 8-µm-thick sections, and then placed on poly-L-lysine (Sigma, St. Louis, MO) and gelatin (BD, Franklin Lakes, NJ) slides and dried for 24 h at 40°C. The sections were dewaxed in 100% xylene and rehydrated in a decreasing ethanol series. They were then washed in PBS-0.1% Triton X-100 (PBST); and blocked with 2% BSA in PBST at RT. Overnight incubation followed (at 4°C) with polyclonal anti-AeNHE8 antibody (WK-215 or WK-69) diluted 1:500 in 1% BSA/PBST. Washing was done with PBST containing 2% goat serum (Sigma) and 0.1% BSA. Secondary antibodies (Jackson Immunoresearch Labs, West Grove, PA): Cy3-conjugated goat-anti-rabbit IgG (for NHE8 detection,1:1,000 dilution) and Phalloidin-Alexa488 (for Actin F detection, diluted 1:100). Both were diluted in 0.1% BSA/2% goat serum/PBST; incubation was carried out in the dark at RT for 1 h. Tissues were again washed and mounted in Shur/Mount media (Electron Microscopy Sciences, Hatfield, PA). Images were obtained using a Zeiss Axioplan laser-scanning confocal microscope (LSM 510; Institute of Integrative Genome Biology, University of California, Riverside) at x10, 40, and 100 magnification. All images were imported into Adobe PhotoShop (Version 7.0) for assembly and annotation.
A similar procedure was followed in localizing AeNHE8 expressed in PS120 cells. Briefly, stable cell lines expressing untagged AeNHE8 or c-Myc tagged AeNHE8 were grown on single-chamber Labtek glass slides (Nunc, Rochester, NY). Cells were fixed, permeabilized, and incubated with polyclonal anti-AeNHE8 (WK-69) or monoclonal anti-Myc (9E10, Santa Cruz Biotechnology) antibodies at 1:100 and 1:800 dilution, respectively. The cells were washed and stained with secondary antibodies: Cy3-conjugated goat-anti-rabbit IgG or Cy3-conjugated goat-anti-mouse IgG, respectively (both at 1:1,000 dilution), and Alexa-488 (for Actin F detection, diluted 1:100). Images were acquired using a confocal fluorescence microscope.
Yeast cell lysis and membrane fraction recovery. Yeast AXT3 cells expressing AeNHE8 and control cells transformed with a recircularized pYES2.1 vector were cultured in 2% glucose minimal medium. Cells were harvested and inoculated into galactose media (to an initial OD600 of 1) for induced protein expression. All batches were harvested after 20-h growth at 30°C and lysed using glass beads in lysis buffer (50 mM KH2PO4, pH 7.4, 500 mM NaCl, 20% glycerol) supplemented with complete inhibitor cocktail (Roche GmbH), 0.2 mM PMSF, 1 µg/ml pepstatin, and 50 mM NaF (all Sigma). Glass beads were removed by filtration and the lysate was centrifuged at 4,000 g to remove cell debris, the supernatant was then centrifuged at 14,600 g to remove mitochondria, and again further centrifuged at 200,000 g for 90 min. The pellets were resuspended in liposome reconstitution buffer [20 mM BTP/MES, pH 7.5, 10% glycerol, 25mM (NH4)2SO4] at a concentration of 8 mg/ml [as determined by the BCA assay (Pierce) with BSA standards] and stored immediately at 80°C. These membrane fractions were used in vesicle reconstitution and immunoblotting.
Immunoprecipitation. PS120 cells expressing untagged AeNHE8 and c-Myc-tagged AeNHE8 were lysed at 2 x 107 cells/ml lysis buffer [50 mM Tris·HCl, pH 7.4, 300 mM NaCl, 5 mM EDTA, and 1% (wt/vol) Triton X-100] supplemented with protease inhibitor cocktail (Roche, Germany) and PMSF. Cell debris was removed by centrifugation at 14,000 g for 15 min, 4°C. Samples were then precleared by an end-over-end incubation for 1 h, 4°C with Protein A-agarose beads (Pierce) prewashed with lysis buffer. Samples were recovered by pelleting the beads and added into Protein A agarose that had been preincubated overnight (4°C) with monoclonal anti-cMyc (Santa Cruz Biotechnology) antibody and incubated for 4 h, 4°C on a tube rotator. The beads were pelleted by centrifugation (13,000 g, 2 s), and the supernatant discarded and washed four times with ice-cold wash buffer [50 mM Tris·HCl, pH 7.4, 300 mM NaCl, 5 mM EDTA, and 0.1% (wt/vol) Triton X-100] and once with ice-cold PBS. The beads were then boiled in 1x SDS sample loading buffer and assayed for presence of immunoprecipitated protein by immunoblotting.
Immunoblotting. IP samples and membrane fractions from the yeast lysate were subjected to SDS-PAGE separation in 10% polyacrylamide gels and transferred onto PVDF membranes (Millipore, Billerica, MA) essentially as described [Sambrook, 2001 #127]. The membranes were blocked in 5% nonfat skim milk, 0.1% Tween-20 in tris-buffered saline (TBS: 150 mM NaCl and 20 mM Tris, pH 7.5) for 1 h. followed by an overnight incubation (at 4°C) with primary anti-NHE8 antibody (WK-69) at 1:2,000 dilution. The secondary antibody, donkey anti-rabbit-horseradish peroxidase (Jackson Immunoresearch Labs) was used at a dilution of 1:5,000. Immunoreactive bands were visualized by enhanced chemiluminescence (GE Healthcare, Buckinghamshire, UK).
Reconstitution of functional proteoliposomes. A modification of the freeze-thaw/sonication methods described in Refs. 23, 44 was used. Briefly, 60 mg/ml of soybean phospholipids type II-S (Sigma) were sonicated to clarity; the lipid suspension was mixed with yeast membrane fractions at a lipid:protein ratio of 10:1 to a final volume of 860 µl in reconstitution buffer containing 20 mM BTP-MES, pH 7.5, 10% glycerol, 25mM (NH4)2SO4 and 2.5 mM pyranine. The mixture was sonicated for 4 x 30 s at 20 W with intermittent pulses using a Branson 450 sonifier, and then rapidly frozen in dry ice and subsequently thawed and resonicated for 3 x 10 s. The mixture was then loaded into a Sephadex G-50 column (Amersham Biosciences, Buckinghamshire, UK) and the eluate was recovered by centrifugation at 180 g. Eluted proteoliposomes were diluted five times in the same buffer and then centrifuged at 100,000 g for 30 min. The concentrated proteoliposomes were resuspended in reconstitution buffer and stored at 80°C until used. Control proteoliposomes were prepared similarly, but from AXT3 cells transformed with empty vector. All preparatory steps were conducted at 4°C.
Measurement of buffering capacity.
Buffering capacity of proteoliposomes was measured in degassed reconstitution buffer at room temperature (25°C) following a modification of previous methods (7, 47). Briefly, proteoliposomes were diluted 25-fold in reconstitution buffer standardized at pH values 6.5 and 7.5. Known amounts of either NaOH or HCl were added to alkalinize or acidify the suspension. Resting pH values were plotted against buffering capacity. It was assumed that [CO2] was sufficiently low to reduce the equation
total =
i +
CO2 to
total = dB/dpH =
1 (where dB is the amount of strong base that would have to be added to the buffer to raise pH by dpH). The mean buffering value used in H+ flux calculations was derived from buffering capacities at pH 6.6 and 6.8 encompassing the pH range relevant to the initial alkalinization of experimental proteoliposomes after addition of cations.
Measurement of proton efflux in vitro.
Change in pyranine fluorescence with pH was measured as the 515-nm emission after excitation at 440 nm using a Pathway HT fluorescence microscope (Atto Bioscience) equipped with a high-resolution Hamamatsu CCD camera. Experimental and control proteoliposomes (25 µl) were acidified following the NH4+/NH3 prepulse technique (47) by addition into NH4+-free reconstitution buffer (i.e., 20 mM BTP/MES, pH 7.5, 10% glycerol) in 1 ml chambered Labtek glass slides (Nunc, Rochester, NY) at room temperature (25°C). Fluorescence measurements commenced after allowing the baseline signals to stabilize. Cation/H+ exchange was initiated by addition of Na+, K+, Li+, and choline chloride salts. Calibration of intravesicular pH against change in pyranine's fluorescence was done using the high potassium/nigericin method (49) equilibration of standardized pH buffers (20 mM BTP/MES, 10% glycerol, 150 mM K+) set at pH 6.0, 6.5, 6.8, 7.0, 7.2, 7.5, and 8.0. A fluorescence/pH calibration curve was prepared for each data set. Final nigericin concentration was 0.5 µM. To inhibit Na+/H+ exchange activity, 50 µM EIPA or 10 µM benzamil-HCl (Sigma) was added into the buffers before addition of proteoliposomes. Exchange activity was stopped by addition of 25 mM (NH4)2SO4. To quantify the proton fluxes, the net initial rate, i.e., dpH/dt (for t = 25 s), was calculated from the 515-nm emission fluorescence (
F440) resulting from addition of chloride cations at 15, 30, 60, 100, and 150 mM concentrations after correcting for the buffering capacity of 20 mM BTP-MES at the starting pH i.e., JH =
total x dpHi/dt. We did not attempt using BCECF in either the liposomes or the PS120 cell line.
EIPA inhibition assay. PS120 cells expressing AeNHE8::c-Myc were maintained under G418 selection in DMEM media. 22Na+ uptake in PS120 cells was done in 12-well format as previously described (40). Briefly, the culture medium was aspirated and wells were washed twice with 1 ml of acid load buffer (50 mM NH4Cl, 70 mM choline chloride, 1 mM MgCl2, 2 mM CaCl2, 5 mM glucose, 20 mM HEPES-Tris, pH 7.4) and incubated in 1 ml of the same buffer for 30 min at 37°C, 5% CO2 (32). Cells were then washed in choline chloride buffer (135 mM choline chloride, 1 mM MgCl2, 2 mM CaCl2, 5 mM glucose, 20 mM HEPES-Tris, pH 7.4) and incubated for 5 min at room temperature in 250 µl/well of the same buffer supplemented with 2 mM ouabain and 100 µM bumetanide. To initiate 22Na+ uptake, 250 µl of uptake solution (74 kBq/ml of carrier-free 22Na+ in choline chloride buffer) were added and cells were incubated for 2 min at room temperature. Uptake solution was also supplemented with 2 mM ouabain and 100 µM bumetanide. To determine AeNHE8's sensitivity to EIPA [5-(N-ethyl-n-isopropyl)-amiloride], H+-activated 22Na+ uptake was measured in the presence of varying concentrations of EIPA (50 nM to 0.1 mM). Uptake was stopped by adding 1 ml of ice-cold stop solution (135 mM NaCl, 1 mM MgCl2, 2 mM CaCl2, 5 mM glucose, 4 mM KCl, 20 mM HEPES-Tris, pH 7.4). Cells were quickly rinsed four times with the stop solution and then lysed in 0.5 ml of 0.5 N NaOH and neutralized with an equal volume of 0.5 N HCl. The solubilized lysate was added to 3 ml of scintillation fluid and counted using a Beckman liquid scintillation counter (Fullerton, CA). Background radioactivity levels were determined from control nontransfected cells. Data were normalized to protein concentration as measured using the BCA assay (Pierce). 22Na+ uptake values (expressed as % of maximal activity) attributable to the Na+/H+ exchanger were calculated as the net 22Na+ influx after subtracting background levels in the absence (0 µM) and the presence of 100 µM EIPA. Data (represented as means ± SE) were derived from the average of three experiments each performed in triplicate and analyzed using Origin 6.1 (OriginLab, Northampton, MA).
| RESULTS |
|---|
|
|
|---|
|
|
6.6 as determined by the diminution of pyranine fluorescence after signal calibration. A plot of variation of fluorescence with pH indicated that change in pyranine fluorescence was linear over the 6.5 to 7.5 range (Fig. 3A), and this was subsequently used in calibrating
F against
pH in the experimental proteoliposomes by linear regression.
|
7.5 as assessed from the resting fluorescence (Fig. 3B).
In the experimental proteoliposomes, chloride cations of Na+, K+, and Li+ at concentrations of 15, 30, 60, 100, and 150 mM were used to generate a curve of variation of the rate of exchange (measured as increase in pyranine's fluorescence at 515 nm and assumed to be proportional to rate of H+ efflux) against cation concentration. The experiments were stopped after
450 s with the addition of 25 mM (NH4)2SO4; alternatively, 0.5 µM nigericin was added to equilibrate the internal and bulk buffer pH. In this case too, the fluorescence was observed to rise sharply. When Na+ and K+ ions were added, there was rapid pH elevation while Li+ had an effect about twofold less efficient. Fluorescence recovery after addition of 150 mM Na+ attained the equivalent pH of
7.05. Alkalinization resulting from addition of choline chloride was minimal. We also observed negligible increase in fluorescence in the control proteoliposomes upon addition of 150 mM Na+ and K+ which could be attributed to some minor ion leakage (Fig. 3B and data not shown). In all cases, the ion exchange reaction exhibited saturable kinetics with increased cation concentration (Figs. 3B and 4A). Last, dilution of proteoliposomes into buffer containing 25 mM NH4+ did not result in any vesicle acidification, and subsequently, addition of cations also had no effect on fluorescence emission.
|
80 mM (data not shown). The maximum rate of alkalinization for sodium was 64 µM/s (which corresponds to 3 x 103
pH/s). The three cations Na+, K+, and Li+ all yielded approximate Hill constant values of one (h = 1; Fig. 4B).
AeNHE8 expression and pharmacological properties in PS120 cells.
To explore the expression and pharmacological properties of AeNHE8, we expressed the exchanger in the NHE-deficient PS120 cells. Expression of c-Myc tagged AeNHE8 in stably transfected PS120 cells was confirmed by immunolocalization using both WK-69 and anti-c-Myc antibodies. Both antibodies gave identical results. But unlike human NHE8 which localizes intracellularly in human cell lines (28), AeNHE8 localizes to the plasma membrane and intracellular compartments (Fig. 5, A and B). To further ascertain the specificity of the antibodies employed in the study, lysates from PS120 cells stably expressing untagged AeNHE8 (control) and c-Myc tagged AeNHE8 were immunoprecipitated (IP) with anti-cMyc monoclonal antibody. The IP samples were immunoblotted with anti-NHE8 polyclonal antibody WK-69. A band running at
70 kDa was observed (Fig. 6A, lane 2), that was absent in the control lane (Fig. 6A, lane 1). In yeast cells, AeNHE8 is expressed as a similarly sized protein, which is also detectable by the anti-NHE8 WK-69 antibody (Fig. 6B, lane 2). No protein was detected in yeast cells not expressing NHE8.
|
|
|
|
| DISCUSSION |
|---|
|
|
|---|
In nonblood fed A. aegypti mosquitoes, NHE8 is exclusively expressed in the apical membrane of principal cells, which comprise the major cell type in the Malpighian tubules, with no expression in stellate cells. There was also no expression in the midgut. This exclusivity in expression pattern may be an indicator that it has a defined transport function and is not a housekeeping exchanger. Its localization in the plasma membrane of the Malpighian tubules, gastric caecae, and the NHE-deficient PS120 cells distinguish it from human NHE8 expression in Golgi and post-Golgi compartments in human cell lines (28), or the intracellular localization in punctate cytoplasmic structures of NHE8:GFP in transgenic C. elegans (30); but it is similar to NHE8 expression in the apical membrane of rat kidney proximal tubules (17, 58). We must note, however, that while it is easy to speculate on AeNHE8 function in the Malpighian tubules, its function in the larval gastric caecae is unclear. There were no obvious differences in AeNHE8 expression between the proximal and distal regions suggesting that the exchanger's function in these poorly characterized resorbing/secreting cells is not spatially differentiated.
AeNHE8 runs at
66 kDa (Fig. 6B) when expressed in yeast AXT3 cells. When tagged with a c-Myc epitope and expressed in mammalian lung fibroblast PS120 cells, the protein runs at
70 kDa which is closer to the estimated size of a 73-kDa protein (Fig. 6A). We confirmed the specificity of the antibodies used in this study by immunoprecipitating c-Myc tagged AeNHE8 overexpressed in PS120 cells using antibodies directed at the c-Myc epitope (Fig. 6A). The small discrepancy in mass observed in the exchanger expressed in PS120 cells and that in yeast could be a due to the frequently anomalous migration of hydrophobic membrane proteins in SDS-PAGE gels. Another plausible explanation is that the protein undergoes posttranslation modification such as glycosylation given that there are several predicted N-glycosylation sites in the exchanger's protein sequence.
The ease of gene manipulation in baker's yeast makes it an attractive model in studying protein function. In this study, we took advantage of yeast cells' sensitivity to high concentration of sodium in the cytoplasm to establish the function of the mosquito exchanger. Sodium tolerance in yeast involves either extrusion through the plasma membrane (45) or sequestration into vacuoles (13). The four plasma membrane Na+-ATPases (ENA14) (13) and the plasma membrane Na+/H+ antiporter NHA1 (39) extrude sodium from the cells, whereas the prevacuolar exchanger NHX1 (29) sequesters it in vacuoles. The yeast strain AXT3 has disruptions on all three classes of genes which renders it highly sensitive to high sodium (42). The functionality of NHX1 can also be tested by assaying the yeast cells' tolerance to hygromycin B, although the precise mechanism by which the exchanger imparts this resistance is not yet well understood (15). When expressed in AXT3 cells, AeNHE8 conferred tolerance to a sodium concentration as high as 70 mM (data not shown and Fig. 2). The cells were also able to grow at up to 100 µg/ml hygromycin B indicating that the mosquito exchanger can complement endogenous NHX1 activity. Wild-type yeast cells can grow in media with a maximum sodium concentration of 200 mM (43). Since AeNHE8 is clearly functional in yeast vacuoles, a proportion of the improved tolerance to Na+ must necessarily be attributable to vacuolar sequestration. In contrast, expression of AeNHE8 in W
3 cells (which lack the potassium uptake proteins TRK1 and TRK2) (43) grown in low-K+ AP media offered no improvement in K+ uptake (data not shown) confirming, as expected, that the exchanger cannot function as a potassium channel.
Pyranine has previously been shown to be an accurate tool in measuring intravesicular and intracellular pH within the pH range of 6.5 and 7.8 (14, 52) which falls within the physiologically relevant pH range in the mosquito Malpighian tubules (37). Furthermore, yeast membranes have been shown to be efficiently reconstituted into phospholipid proteoliposomes with entrapped pyranine using either the detergent solubilization method (53) or by physical means (23, 44). We used the latter method and confirmed the integrity of the proteoliposomes prepared by achieving sustained intravesicular acidification using the NH3/NH4+ prepulse protocol (47). A 25-fold dilution of ammonium concentration resulted in reduction of intravesicular pH by 0.9 units from 7.5 (pH of the reconstitution buffer) to 6.6 (Fig. 3A). A similar range was observed in proteoliposomes prepared using the detergent solubilization method (53). When subjected to a steep sodium gradient of 150 mM, the pH recovers halfway to 7.05 in a time period of
8 min (Fig. 3A). The incomplete pH recovery by cation/H+ exchange may be attributed to the proportion of correctly oriented and functional exchangers in the proteoliposomes: 50% assuming complete randomness in protein orientation with physical proteoliposome reconstitution. Additionally, the nonendogenous nature of the phospholipid environment might not fully recapitulate exchanger function. The fluorescence recovery is, however, full (i.e., to
pH 7.5) when the bulk external NH4+ concentration is raised to match the initial concentration of the reconstitution buffer at 25 mM. A rapid rise in fluorescence was also observed when nigericin was added to the proteoliposomes even after leveling of
F following cation addition (data not shown) indicating ion concentrations were still not at equilibrium inside and outside the proteoliposomes. The organic cation choline did not cause any significant fluorescence change (Fig. 3B) nor did the addition of cations into control proteoliposomes prepared from membranes of control cells transformed with empty vector. Thus the fluorescence signal (and pH) recovery observed in the experimental proteoliposomes is apparently mediated by AeNHE8.
The in vitro assays using reconstituted proteoliposomes determined that AeNHE8 had a moderately high affinity for Na+ and K+ with Km values of 33 and 41 mM, respectively (Fig. 4A), with sodium having a maximum velocity of 3 x 103
pH/s. It should be noted, however, that the above cation affinity values are about fourfold less than their physiological concentrations in the mosquito (34), meaning that the exchangers are saturated with the cations at steady state (12). These Km values are within the range (350 mM) reported for other NHEs in different cell types and vesicle preparations (2, 8). Compared with its mosquito homolog, human NHE8 has a much lower affinity at 130 and 75 mM for Na+ and K+, respectively, as observed in similar in vitro Na+ and K+/H+ assays (28). The similarity of Na+ and K+ affinity values might be interesting when interpreted in the context of postblood meal diuresis. Although this could simply result from an accommodative cation binding site, the fact that the secretion of K+ peaks almost an hour (9) after Na+ raises questions on whether the exchanger contributes to the secretion of both cations.
NHE isoforms have routinely been distinguished by their susceptibility to inhibition by amiloride and its analogs, notably EIPA, which is most potent. The amiloride binding site has been shown to be located within the fourth transmembrane region (8, 12) where a pocket of residues is well conserved among NHEs. This pocket has the sequence "VFFLFLLPPII" and coincides with residues 160170 in the quintessentially amiloride-sensitive human NHE1 (11). Substitution of the fourth leucine residue with phenylalanine "VFFFFLLPPII" results in insensitivity (11). Furthermore, in the relatively amiloride-insensitive NHE3, the sequence is "VFFFYLLPPII" (8, 40). In AeNHE8, this sequence is "AFFLVLLPPII" (Fig. 1) and we expected it to be sensitive to amiloride based on its sequence fidelity. Besides, the existence of an amiloride-sensitive NHE in the apical membrane of A. aegypti's Malpighian tubules has been proposed from electrophysiological studies of whole tubules showing that EIPA disrupts membrane conductance and inhibits salt and fluid secretion (35). We first attempted to understand the sensitivity of AeNHE8-dependent exchange activity to known inhibitors of NHEs using the reconstituted lipid vesicles. EIPA (dissolved in DMSO) was added at concentrations of 550 µM to both experimental and control proteoliposomes. A steady increase in fluorescence in both experimental and control proteoliposomes (data not shown) was observed even without addition of cations making the system unsuitable for determining AeNHE8's susceptibility to inhibition by EIPA; similar observations have been previously reported (53). The effect was not caused by DMSO since no change in fluorescence was observed with addition of the solvent alone. Because the anomaly was also observed in vesicles prepared from soybean phospholipids alone, it likely resulted from perturbation of the vesicular lipid bilayer by EIPA. The resultant leakage would then have caused rapid dissipation of the H+ gradient resulting in fluorescence changes similar to those observed with an increase in pH. Benzamil, another NHE inhibitor, had no significant inhibitory effect on NHE8 activity which was in agreement with findings that it is a poor inhibitor of Na+/H+ exchange in the Malpighian tubules of A. aegypti (35).
To circumvent this problem, we used the PS120 cell line, an NHE-deficient clone derived from Chinese hamster lung fibroblast cells (38) that has been routinely used in studying pharmacological properties of mammalian NHEs. Based on its expression in Malpighian tubules, AeNHE8 would be expected to function in the forward mode extruding Na+ from principal cells into the lumen. But NHEs have been known to function in reverse mode under sufficiently strong electrochemical gradient (54). We developed stable PS120 cell lines expressing tagged and untagged AeNHE8 and confirmed the protein's expression in the plasma membrane using both anti-NHE8 and anti-c-Myc epitope antibodies (Figs. 5 and 6). We then subjected the cells to an acid load in Na+-free buffer and assayed for EIPA-sensitive 22Na+ uptake. Confirming our prediction, AeNHE8 showed a dose-dependent sensitivity to EIPA with an IC50 of 1.75 µM. Compared with other NHE isoforms, this would rank it as a moderately amiloride-sensitive exchanger (27).
Physiological measurements of transepithelial Na+ and K+ concentrations and estimations of H+ flux mediated by the V-ATPase suggest a cation/H+ exchange stoichiometry of 1:1 across Malpighian tubule's apical membrane (22, 55). In other Na+/H+ exchange activity studies, intracellular and luminal pH appear to be linked to sodium concentration. For instance, removal of extracellular Na+ also decreases pHi in the Malpighian tubule cells (35, 37), and inhibition of exchanger activity with EIPA decreases steady-state pHi in addition to blocking Na+ and fluid secretion (35). These observations and the pH neutrality of mosquito Malpighian tubules (37) appear to preclude the need for an electrogenic exchanger. Although we could not conclusively settle this question, the calculated Hill constants of 1 for both Na+ and K+ (Fig. 4B) are consistent with this view. If these observed results are upheld, then AeNHE8's electroneutrality would be in contrast with the K+/2H+ exchange in lepidopteran gut (25) or the 2Na+/H+ stoichiometry in crustacean NHEs (1).
It is important to note that only five NHEs (isoforms 3, 6, 8, 9, and 10) (41) have been identified in the available dipteran genomes compared with nine in both mammals and C. elegans (7). Of those five, the tentatively assigned NHE9 and 10 differ significantly from the rest in sequence and evolutionary relationship while retaining the NHE signature motif (41). Remarkably, there is no apparent equivalent of the mammalian housekeeping isoform NHE1 in dipteran genomes. However, one cannot the exclude the possibility that the five NHE genes in insects can produce multiple splice variants to generate diversity from a smaller number of genes. Indeed, AeNHE3 is expressed as at least two splice variants that differ in their content of regulatory sites (19), thereby raising the possibility of differential targeting and regulation.
Finally, based on this expression and functional data, and also on available electrophysiological data (4, 22, 31, 34, 35), one might speculate that AeNHE8's activity is coupled to the proton gradient created by the apical V-ATPase to secondarily drive Na+ or K+ extrusion across the tubule's epithelia. Future studies should reveal whether this is indeed the case.
| GRANTS |
|---|
|
|
|---|
Present address of A. K. Pullikuth: Dept. of Pharmacology and Experimental Therapeutics, Louisiana State University Health Sciences Centre, New Orleans, LA 70112.
| ACKNOWLEDGMENTS |
|---|
| FOOTNOTES |
|---|
The costs of publication of this article were defrayed in part by the payment of page charges. The article must therefore be hereby marked "advertisement" in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.
| REFERENCES |
|---|
|
|
|---|
This article has been cited by other articles:
![]() |
A. M. Evans, K. G. Aimanova, and S. S. Gill Characterization of a blood-meal-responsive proton-dependent amino acid transporter in the disease vector, Aedes aegypti J. Exp. Biol., October 15, 2009; 212(20): 3263 - 3271. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. R. Harvey Voltage coupling of primary H+ V-ATPases to secondary Na+- or K+-dependent transporters J. Exp. Biol., June 1, 2009; 212(11): 1620 - 1629. [Abstract] [Full Text] [PDF] |
||||
![]() |
P. M. Piermarini, D. Weihrauch, H. Meyer, M. Huss, and K. W. Beyenbach NHE8 is an intracellular cation/H+ exchanger in renal tubules of the yellow fever mosquito Aedes aegypti Am J Physiol Renal Physiol, April 1, 2009; 296(4): F730 - F750. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. R. Harvey, D. Y. Boudko, M. R. Rheault, and B. A. Okech NHEVNAT: an H+ V-ATPase electrically coupled to a Na+:nutrient amino acid transporter (NAT) forms an Na+/H+ exchanger (NHE) J. Exp. Biol., February 1, 2009; 212(3): 347 - 357. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. P. Day, S. Wan, A. K. Allan, L. Kean, S. A. Davies, J. V. Gray, and J. A. T. Dow Identification of two partners from the bacterial Kef exchanger family for the apical plasma membrane V-ATPase of Metazoa J. Cell Sci., August 1, 2008; 121(15): 2612 - 2619. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. J. Lee, J. M. Harlow, M. P. Limberis, J. M. Wilson, and J. K. Foskett HCO3- Secretion by Murine Nasal Submucosal Gland Serous Acinar Cells during Ca2+-stimulated Fluid Secretion J. Gen. Physiol., July 1, 2008; 132(1): 161 - 183. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Visit Other APS Journals Online |